SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133372 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133372
Domain Number 1 Region: 24-499
Classification Level Classification E-value
Superfamily ALDH-like 5.5e-134
Family ALDH-like 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133372   Gene: ENSMUSG00000053644   Transcript: ENSMUST00000174518
Sequence length 511
Comment pep:known chromosome:GRCm38:18:56524722:56572951:-1 gene:ENSMUSG00000053644 transcript:ENSMUST00000174518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGRGEVITTYCPANNEPIARVRQASLKDY
EETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKILVEGIGEVQ
EYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMWNPLGLVGIITAFNFPVAVFGWNNAIA
LITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSLVCGGADIGTTMARDERVN
LLSFTGSTQVGKEVALMVQERFGKSLLELGGNNAIIAFEDADLSLVVPSVLFAAVGTAGQ
RCTTVRRLFLHESIHNEVVDRLRSAYSQIRVGNPWDPNILYGPLHTKQAVSMFVRAVEEA
KKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHDAPIVHQETFAPILYVFKFQDEEEVFEWN
NEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRES
GSDAWKQYMRRSTCTINYSTSLPLAQGIKFQ
Download sequence
Identical sequences ENSMUSP00000065089 NP_001120810.1.92730 ENSMUSP00000133372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]