SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133383 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133383
Domain Number 1 Region: 7-166
Classification Level Classification E-value
Superfamily ARM repeat 8.64e-30
Family Armadillo repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133383   Gene: ENSMUSG00000037708   Transcript: ENSMUST00000173763
Sequence length 167
Comment pep:putative chromosome:GRCm38:2:18699084:18732034:1 gene:ENSMUSG00000037708 transcript:ENSMUST00000173763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAEQATKPQNIETLQNAGIMSLLRPLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKG
DILPQLVYSLAEQNCVYKKAAAFVLRAVGKHSPQLAQATVDCGALDSLVICLEDFDPGVK
EAAAWALAYIARHNAELSQAVVDAGAVPLLVLCIQEPETALKRIAAS
Download sequence
Identical sequences G3UWQ4
ENSMUSP00000133383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]