SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133544 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133544
Domain Number 1 Region: 76-191
Classification Level Classification E-value
Superfamily SMAD MH1 domain 8.24e-32
Family SMAD MH1 domain 0.00088
Further Details:      
 
Domain Number 2 Region: 194-265
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000307
Family SMAD domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133544   Gene: ENSMUSG00000025880   Transcript: ENSMUST00000174843
Sequence length 265
Comment pep:novel chromosome:GRCm38:18:75368990:75393986:1 gene:ENSMUSG00000025880 transcript:ENSMUST00000174843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLWRSRAPGGEDEEEGVGGGGGGGELRGEGATDGRAYGAGGGGAGRAGCCLGKAVRGAKG
HHHPHPPTSGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGR
LDCRLGPGAPASAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELV
CCNPHHLSRLCELESPPPPYSRYPMDFLKPTDSQLLLEPGDRSHWCVVAYWEEKTRVGRL
YCVQEPSLDIFYDLPQGNGFCLGQL
Download sequence
Identical sequences ENSMUSP00000133544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]