SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133859 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133859
Domain Number 1 Region: 9-214
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.79e-30
Family Tyrosine-dependent oxidoreductases 0.0000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133859   Gene: ENSMUSG00000033735   Transcript: ENSMUST00000174286
Sequence length 219
Comment pep:novel chromosome:GRCm38:6:85134098:85137762:-1 gene:ENSMUSG00000033735 transcript:ENSMUST00000174286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAGGLGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEELGAQQP
DLKVVLAAADLGTEAGVQRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFLNVNDLAE
PYKGWGLYCAGKAARDMLYQVLAAEEPSVRVLSYAPGPLDNDMQQLARETSKDPELRSKL
QKLKSDGALVDCGTSAQKLLGLLQKDTFQSGAHVDFYDC
Download sequence
Identical sequences G3UXX3
ENSMUSP00000133859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]