SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133903 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133903
Domain Number 1 Region: 9-66
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000102
Family BTB/POZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133903   Gene: ENSMUSG00000049823   Transcript: ENSMUST00000173093
Sequence length 68
Comment pep:known chromosome:GRCm38:17:34879483:34895445:1 gene:ENSMUSG00000049823 transcript:ENSMUST00000173093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRD
QFLLNPSS
Download sequence
Identical sequences G3UY12
ENSMUSP00000133903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]