SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133918 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133918
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.00000000000000393
Family Reductases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133918   Gene: ENSMUSG00000032872   Transcript: ENSMUST00000174294
Sequence length 89
Comment pep:known chromosome:GRCm38:9:87058939:87077381:1 gene:ENSMUSG00000032872 transcript:ENSMUST00000174294 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
VSGPEGDFKVSKLQEVEDLFLLAAGTGFTPMVTVLNYALSHMSSLRKVKLMFFNKTEDDI
IWRCQLEKLALREKRMEWQTGTHITSSSL
Download sequence
Identical sequences G3UY26
ENSMUSP00000133918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]