SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133970 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133970
Domain Number 1 Region: 40-279
Classification Level Classification E-value
Superfamily ALDH-like 4.32e-58
Family ALDH-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133970   Gene: ENSMUSG00000053644   Transcript: ENSMUST00000174704
Sequence length 321
Comment pep:known chromosome:GRCm38:18:56526750:56562218:-1 gene:ENSMUSG00000053644 transcript:ENSMUST00000174704 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
RVPRRLCVQSVKTSKLSGPWSRPAAHMSTLLIHHPQYAWLQDLGLREDNEGVYNGSWGGR
GEVITTYCPANNEPIARVRQASLKDYEETIGKAKKAWNIWADIPAPKRGEIVRKIGDAFR
EKIQLLGRLVSLEMGKILVEGIGEVQEYVDVCDYAAGLSRMIGGPTLPSERPGHALIEMW
NPLGLVGIITAFNFPVAVFGWNNAIALITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNL
LPGAICSLVCGGADIGTTMARDERVNLLSFTGSTQVGKEGKACWSLEETMPLLLSRTRTS
AWLFRQFCLPPWEQLGKGVPL
Download sequence
Identical sequences G3UY72
ENSMUSP00000133970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]