SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134082 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134082
Domain Number 1 Region: 35-132
Classification Level Classification E-value
Superfamily ALDH-like 7.98e-27
Family ALDH-like 0.00000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134082   Gene: ENSMUSG00000035561   Transcript: ENSMUST00000172750
Sequence length 132
Comment pep:known chromosome:GRCm38:4:45799121:45802858:1 gene:ENSMUSG00000035561 transcript:ENSMUST00000172750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTARLLLPRLLCLQGRTTSYSTAAALPNPIPNPEICYNKLFINNEWHDAVSKKTFPTVN
PTTGEVIGHVAEGDRADVDLAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVY
LASLETLDNGKP
Download sequence
Identical sequences ENSMUSP00000134082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]