SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000134520 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000134520
Domain Number 1 Region: 256-339
Classification Level Classification E-value
Superfamily E set domains 1.49e-19
Family E-set domains of sugar-utilizing enzymes 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000134520   Gene: ENSMUSG00000053552   Transcript: ENSMUST00000140169
Sequence length 541
Comment pep:known chromosome:GRCm38:2:130295939:130370481:1 gene:ENSMUSG00000053552 transcript:ENSMUST00000140169 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MFPAQDALPRGGLHLKEEPLLPSSLGSVRSWMQSAGILDSNTAAQSGVGLARAHFEKQPP
SNLRKSNFFHFVLAMYDRQGQPVEVERTAFIDFVEKDREPGTEKTNNGIHYRLRLVYNNG
LRTEQDLYVRLIDSMSKQAIIYEGQDKNPEMCRVLLTHEIMCSRCCDRKSCGNRNETPSD
PVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVSVDGHVLAVSDNMFVHNNSK
HGRRARRLDPSEAATPCIKAISPGEGWTTGGATVIIIGDNFFDGLQVVFGNVLLWSELIT
PHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFVYTALNEPTIDYGFQRLQKVIPRH
PGDPERLPKEVLLKRAADLAEALYGVPSSNQELLLKRAADVAEALYSAPRAPAPLGPLAP
SHPHPAVVGINAFSSPLAIAVGDTTPEPGYARSCGSASPRFAPSPGSQQSSYGSGLGAGL
GSYGAPGVTGLGVPGSPSFLNGSTATSPFAKERLRPCAAPTQFPIAGLPQSPQRGASRPA
F
Download sequence
Identical sequences ENSMUSP00000134520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]