SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000135268 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000135268
Domain Number 1 Region: 40-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000092
Family Ubiquitin-related 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000135268   Gene: ENSMUSG00000069678   Transcript: ENSMUST00000176089
Sequence length 108
Comment pep:putative chromosome:GRCm38:6:83078691:83080757:1 gene:ENSMUSG00000069678 transcript:ENSMUST00000176089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDILAKTRIKMSFRAEVRHLRRVLCHRL
MLNPQHVQLLFDNEVLPDHMTMKQLWLSRWFGKPSPLLLQYSVKEKRR
Download sequence
Identical sequences H3BK63
ENSMUSP00000135268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]