SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000135419 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000135419
Domain Number 1 Region: 11-86
Classification Level Classification E-value
Superfamily ALDH-like 9.96e-22
Family ALDH-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000135419   Gene: ENSMUSG00000025007   Transcript: ENSMUST00000175967
Sequence length 100
Comment pep:putative chromosome:GRCm38:19:40553427:40554741:-1 gene:ENSMUSG00000025007 transcript:ENSMUST00000175967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTFSPSEVKSLRTEYGDLEVCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQH
VDSACVFWNASTRFSDGYRFGLGKKGRGMESPVALPLWWL
Download sequence
Identical sequences H3BKK0
ENSMUSP00000135419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]