SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136068 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136068
Domain Number 1 Region: 32-114
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-20
Family Canonical RBD 0.00023
Further Details:      
 
Domain Number 2 Region: 115-203
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-18
Family Canonical RBD 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000136068
Domain Number - Region: 339-507
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.000301
Family Adhesin YadA, collagen-binding domain 0.014
Further Details:      
 
Domain Number - Region: 523-547
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00186
Family Eukaryotic ODC-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136068   Gene: ENSMUSG00000094135   Transcript: ENSMUST00000179772
Sequence length 565
Comment pep:known chromosome:GRCm38:Y:12688110:12690064:1 gene:ENSMUSG00000094135 transcript:ENSMUST00000179772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTASLAVEKDNETEQFREGFKIDATKNQQDASKMFIGGLSQEMSKQVLLEYLSKFGEII
DFIIKTDPNTGLSRGFGFVLFKDSATVEKVLQVKDHKVDGKKIEFKRAKALESQFPNKKI
FVGGLNPRLSEEKIRAYFGTFGQIEAIELPLCSDTRERRAFGFIKYMDENSVRKVLENRY
HFIGSSRCEVKMAYPKENPARQLSKRKAIAKDRTRKSVPAVELENNWRGGGSPSFHIMAN
SEAQEANQDAHRAGSYTSRANSDVTLTNACGFRDSPNAFHVNSNVFVTNSTTFIASSNAL
RSSTNTVGVSHYTLDANPNTFLASQYTLGTISNTLRTSQYTLGTYPNALGVSQYALAAYP
NTFGINQYPLEADQNAFWTNQYPLGTYSDAFGIGQYASGTSPNGFGVSQYSLGTNADTFR
TNCFALVANPYNIWTNHYVLATNPNVFRTSQYVLGENPNAFESSQYSVGATQNNFGPNQH
NFGANGNFCGTVGRGGSTGGLNFSQVYGNFLNVCNTLPGFQDSNGDYFVLYSYGAYDVRY
APNYNVQISQSTLLGNDYQRIYSAF
Download sequence
Identical sequences Q9D3U4
ENSMUSP00000136068 ENSMUSP00000136781 ENSMUSP00000136068 ENSMUSP00000136781 ENSMUSP00000049830 NP_001279986.1.92730 NP_083246.1.92730 10090.ENSMUSP00000049830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]