SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136308 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136308
Domain Number 1 Region: 7-121
Classification Level Classification E-value
Superfamily Histone-fold 7.91e-26
Family TBP-associated factors, TAFs 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136308   Gene: ENSMUSG00000096158   Transcript: ENSMUST00000178247
Sequence length 140
Comment pep:known chromosome:GRCm38:6:43210333:43210755:1 gene:ENSMUSG00000096158 transcript:ENSMUST00000178247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERSKDLNMPKAIITRIIKEALQDRVKISKEDLSSISFATSIFVLYATSCANNSAMKGK
HKTPNVSGVLSAMEEMEFQRFITPLKEALEAHRGEQKGKKEAGEQKKKRDKDKRDSEEQD
KSREEADGDEERLEEEEVDN
Download sequence
Identical sequences ENSMUSP00000136308 ENSMUSP00000136308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]