SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136429 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136429
Domain Number 1 Region: 69-189
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000073
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136429   Gene: ENSMUSG00000096194   Transcript: ENSMUST00000179991
Sequence length 498
Comment pep:known chromosome:GRCm38:X:32278394:32280342:1 gene:ENSMUSG00000096194 transcript:ENSMUST00000179991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLVSRVLSCRDSSLLEPQPEDIAGASYIPGSRKRKRNSLEELATSSNVHGPQNQGMYP
HQVLNYIYWKKVKISSNDAYQNLFLDGHDSDIKIRALGRTWCLHKVFLCQSGYFANILKG
TWRESHHGVINLIIKNEDIDTRSLHFVFGALYTDADLSITPLEVPQVLAAACLLRVDRVI
QQCEGIMKETINRNTVCSYYLAAETYRLKAVKTRCFEWLLCNLMVHPSVALYKEVDLKLM
YLLALSSDLLVMQKEIDVYTTLKIWMFLYLNPCWNGTMKQLLQHANNWLSTHMAYVDNIS
FLESEEGLIFQPVFKKLRFQHIICDLTSTTILEQDRLIPMAWLSPIYKQQWLTLLRTQEY
GVIGPQVINEQELEECTMRCGTMIPKDGRYTWKWSVGRLGFPLRVTFTRQCVILRQRCQR
CDGSACHNHIRNVIFRITLVCFDSNKRVTFRKTTGYKILTFEYKEEQIVMKLDSDVLTFP
MCIFCNFLFVNLGNAENK
Download sequence
Identical sequences J3QMS5
10090.ENSMUSP00000100758 ENSMUSP00000136429 ENSMUSP00000100758 ENSMUSP00000136429 NP_001161806.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]