SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136537 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136537
Domain Number 1 Region: 74-145
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 2.75e-19
Family F1F0 ATP synthase subunit C 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136537   Gene: ENSMUSG00000066724   Transcript: ENSMUST00000086013
Sequence length 146
Comment pep:known chromosome:GRCm38:7:23946649:23947237:-1 gene:ENSMUSG00000066724 transcript:ENSMUST00000086013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYACSKFVSTRSLIRSTSLRSTSQLLSRPLSAVELKRPQMPTDESLSSLAVRRPLTSLIP
SRSFQTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSY
AILGFALSEAMGLFCLMVAFLILFAM
Download sequence
Identical sequences P56383
ENSMUSP00000075057 ENSMUSP00000075057 ENSMUSP00000136537 ENSMUSP00000136960 NP_080744.1.92730 10090.ENSMUSP00000075057 ENSMUSP00000075057 ENSMUSP00000136537 ENSMUSP00000140414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]