SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136544 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136544
Domain Number 1 Region: 6-415
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 2.56e-257
Family Phosphoglycerate kinase 0.00000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136544   Gene: ENSMUSG00000066632   Transcript: ENSMUST00000085735
Sequence length 417
Comment pep:known chromosome:GRCm38:12:10898566:10900296:-1 gene:ENSMUSG00000066632 transcript:ENSMUST00000085735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVL
MSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDCVGPEVENACANPAAGTVILLE
NLRFHVEEEGKGKDASGNKVKAEPAKIDAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGM
AFTFLKVLNNMEIGTSLYDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPAGWMGLDCGTESSKKYAEAVGRAKQIVWNGPVGVFEWEAFARGTKSLMDEVV
KATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNV
Download sequence
Identical sequences A0A0P6CFI8 P09411
NP_032854.2.92730 ENSMUSP00000080302 ENSMUSP00000136544 4o3f_A d4o3fa_ 10090.ENSMUSP00000080302 ENSMUSP00000080302 ENSMUSP00000080302 ENSMUSP00000136544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]