SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136782 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000136782
Domain Number - Region: 8-32
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.00955
Family 2-methylcitrate dehydratase PrpD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136782   Gene: ENSMUSG00000040620   Transcript: ENSMUST00000155044
Sequence length 47
Comment pep:known chromosome:GRCm38:11:70992125:70995993:-1 gene:ENSMUSG00000040620 transcript:ENSMUST00000155044 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
HRKAPPRWLPFNARPSSVRLPALFAAASSLSRGPKGLSQSDHFNQHR
Download sequence
Identical sequences J3QJZ5
ENSMUSP00000136782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]