SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000136923 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000136923
Domain Number 1 Region: 10-54
Classification Level Classification E-value
Superfamily LysM domain 0.00000000889
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000136923   Gene: ENSMUSG00000022307   Transcript: ENSMUST00000179393
Sequence length 751
Comment pep:known chromosome:GRCm38:15:41449027:41861045:1 gene:ENSMUSG00000022307 transcript:ENSMUST00000179393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNKLFSRAVVTGQVLYVPDPEYVS
SVESSPSLSPVSPLSPTSSEAEFDKTTTPDVAHPKEAPPASTVSGIRPARVVSSTSEEEE
AFTEKFLKINCKYITIGKGTVSGVLLVTPNNIMFDPHKTDPLVQENGCEEYGIMCPMEEV
MSAAMYKEILDSKIKESLPIELDQLSGRGSCHSKKATGVSAEDADPRARDQGNDSASTAP
RSTEESLSEDAFTESELSPIREELLSSEPRQEKSSDASSESVQTVSQMEVQSLTATSEAA
NVPDRTSSNPGALSHETGLSGLETATKGGDKATESLQEVSGPKEQSTEVKGQDNQDSSHQ
ESSLQQEAGEDSVSSGETVELKEKPAVLKDQQGQELKRDSETEVEELRKLWKTHSMQQAK
QQRDTIQQVSQRESKHSSAAADAHGEGSSLLKEKRRHRLHKFLCLRVGKPMRKTFVSQAS
ATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIYAEDSGEYTREPGFIVVKKMDE
SEANEAPAGEAAAREWEITTREDINSKQVAPAKADLEPESFRPNLSDPSELLLPDQIEKL
TKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPF
KVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYH
GRSHSCKTFGNHTLSKKEDFFIQDIEIWAFE
Download sequence
Identical sequences NP_001123635.1.92730 ENSMUSP00000087553 ENSMUSP00000087554 ENSMUSP00000136923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]