SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137799 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000137799
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00369
Family Myb/SANT domain 0.048
Further Details:      
 
Domain Number - Region: 148-254
Classification Level Classification E-value
Superfamily POZ domain 0.0141
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137799   Gene: ENSMUSG00000042208   Transcript: ENSMUST00000155903
Sequence length 713
Comment pep:known chromosome:GRCm38:11:23564961:23633549:-1 gene:ENSMUSG00000042208 transcript:ENSMUST00000155903 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSRGYPENNNFLNNNNQMVLDMILYPLIGIPQTINWETVARLVPGLTPKECVKRFDELKS
CGSSPVDNQYNPLMATGEGPVETLATYIKSSLLDTQGDFQETPVDQDTVSKAGRHSIATT
RNCSSESENCTARNAGEETGESEGPNMVIHVCDEAKSLKEDFICPRDLLISEMKYFAEYL
SMDAQRWEEVDISVHCDVHIFNWLIKYVKRNTKESKDCEIPALEPGNVISILISSEFLKM
DSLVEQCIQYCHKNMNAIVAAPCNMNCINANLLTRIADLFTHNEIDDLKDKKDKFRSKLF
CKKIERLFDPEYSNPDSRNNAATLYRCCLCKKLLTRETERRIPCIPGKINVDRHGNIIYI
HIRDKTWDVHEYLNSLFEELKSWRDVYWRLWGTVNWLTCSRCYQAFLCIEFSHCQYHSEV
VVYSSTVNSLNTVGTGIYPCCNQKVLRFDPTQLTKGCKVRDHMVVLHDQGENDDSPSCPP
AKILDDLHKHKDVIAVPFLKDAVSDPGVGSCDEKGLEYEILLEPNTPWGSKTGELNAFLS
LKNWTLQLKQQSLFSEEEEYTTGSEVTEDEVGDEEEIAKKQRKKEKPKKFTKPPKKQLSS
PCSQKKEKTLEKSTSRDVSPFVVSMQKNKWDASRSLRFNQDAQREDDQRRMSEITGHLIK
MRLGDLDRVKAKESKEFAGGIYSRLEAQVRASVPVTARQNSSDKNQRMTSLRP
Download sequence
Identical sequences M0QWF3
ENSMUSP00000137799 XP_006514873.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]