SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000137860 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000137860
Domain Number 1 Region: 5-41
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.0000000584
Family D-ribulose-5-phosphate 3-epimerase 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000137860   Gene: ENSMUSG00000026005   Transcript: ENSMUST00000151016
Sequence length 41
Comment pep:known chromosome:GRCm38:1:66700831:66715194:1 gene:ENSMUSG00000026005 transcript:ENSMUST00000151016 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDG
Download sequence
Identical sequences M0QWJ2
ENSMUSP00000137860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]