SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138008 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138008
Domain Number 1 Region: 17-157
Classification Level Classification E-value
Superfamily TRAF domain-like 9.81e-42
Family MATH domain 0.0000185
Further Details:      
 
Domain Number 2 Region: 167-285
Classification Level Classification E-value
Superfamily POZ domain 3.45e-33
Family BTB/POZ domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138008   Gene: ENSMUSG00000094084   Transcript: ENSMUST00000181541
Sequence length 365
Comment pep:known chromosome:GRCm38:3:93669340:93676310:-1 gene:ENSMUSG00000094084 transcript:ENSMUST00000181541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEDMEFENWGSTQSSVEKFCYKWTISNFSFCMGGIQRRITSPVFSSEENKEVAWCLRVY
PKGADKESKDYLSVYLVLLSHLQIPVWAKFKFWIINSQGEKYQKIKSPTVECFLTNEQNG
FKKFLPRDLLLSHRNCLLPEDQLTICCKVTILGRKYNMPSQNITPAIKDPRHLLTDDLGE
LWENSLFTDCCLLVAGHEFRAHKAILAARSPVFRAMFEHEMKESLKTPIKIHNLNPQVFK
EMMGFIYTGKAPHLHSHSMACDVLPAADKYGLVSLKVLCEDALCRNLSVKNATHTLILAD
LHSTEKLKTQALDFIAYYASEVCETSEWKSILESHPHLVAEAFQSLASAQCSFLEPKVIS
GSNQL
Download sequence
Identical sequences P0DMR5
NP_683751.2.92730 ENSMUSP00000091980 10090.ENSMUSP00000076053 ENSMUSP00000091980 ENSMUSP00000138008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]