SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138050 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138050
Domain Number 1 Region: 2-87
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.7e-25
Family Creatinase/aminopeptidase 0.00000493
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138050   Gene: ENSMUSG00000036112   Transcript: ENSMUST00000181470
Sequence length 106
Comment pep:putative chromosome:GRCm38:10:93862249:93865503:-1 gene:ENSMUSG00000036112 transcript:ENSMUST00000181470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAGIDVRLCDVGEAIQEVMESYEVEIDGKTYQVKPIRNLNGHSIGPYRIHAGKTVPIVKG
GEATRMEEGEVYAIETFGSTGKGVVHDDMECSHYMKNFDVGHVPIR
Download sequence
Identical sequences M0QWX0
ENSMUSP00000138050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]