SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138057 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138057
Domain Number 1 Region: 139-324
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.17e-56
Family Extended AAA-ATPase domain 0.00000904
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000138057
Domain Number - Region: 40-69
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.000654
Family RILP dimerisation region 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138057   Gene: ENSMUSG00000020708   Transcript: ENSMUST00000133131
Sequence length 348
Comment pep:known chromosome:GRCm38:11:106256154:106263120:1 gene:ENSMUSG00000020708 transcript:ENSMUST00000133131 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEVCAGGAWRSSGYGDSAGLRAFFSYP
Download sequence
Identical sequences Q8K1K2
ENSMUSP00000138057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]