SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138116 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138116
Domain Number 1 Region: 91-262,309-380
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.1e-38
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138116   Gene: ENSMUSG00000031142   Transcript: ENSMUST00000155090
Sequence length 431
Comment pep:known chromosome:GRCm38:X:7607083:7635193:1 gene:ENSMUSG00000031142 transcript:ENSMUST00000155090 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSESEVGKDTTPEPSPANGTGPGPEWGLCPGPPTVGTDTSGASGLGTPRRRTQHNKHKTV
AVASAQRSPRALFCLTLTNPIRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPSPCASSGSGRSCTLNHTECR
GRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQMEEDLRGYLDWITQAEELDLHDPS
VDGNLGHNCQS
Download sequence
Identical sequences S4R182
ENSMUSP00000138116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]