SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138735 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000138735
Domain Number 1 Region: 397-529
Classification Level Classification E-value
Superfamily CalX-like 1.96e-33
Family CalX-beta domain 0.00000351
Further Details:      
 
Domain Number 2 Region: 529-682
Classification Level Classification E-value
Superfamily CalX-like 3.92e-29
Family CalX-beta domain 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138735   Gene: ENSMUSG00000079055   Transcript: ENSMUST00000182208
Sequence length 928
Comment pep:known chromosome:GRCm38:12:81199446:81333180:-1 gene:ENSMUSG00000079055 transcript:ENSMUST00000182208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWLRLQPLTSAFLHFGLVTFVLFLNCLRAEAGDSGDVPSAGQNNESCSGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGN
FTPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKTSSMSEVHTDEPEDFASKVFFDPCSYQCLENCGAVLLTVVR
KGGDISKTMYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRVEEEQLAEGMLPAILNSLPLPRAVLASPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDAYGELEFKNDETVKTIHI
KVIDDKAYEKNKNYVIEMMGPRMVDMSVQKALLLSPEVTDRKLTVEEEEAKRIAEMGKPV
LGEHPKLEVIIEESYEFKSTVDKLIKKTNLALVVGTHSWRDQFMEAITVSAGGDEDEDES
GEERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHF
GCTIGLKDSVTAVVFVAFGTSVPDTFASKAAALQDVYADASIGNVTGSNAVNVFLGIGLA
WSVAAIYWAMQGQEFHVSAGTLAFSVTLFTIFAFVCLSVLLYRRRPHLGGELGGPRGCKL
ATTWLFVSLWLLYILFATLEAYCYIKGF
Download sequence
Identical sequences S4R2P9
NP_536688.2.92730 ENSMUSP00000138735 ENSMUSP00000063258 10090.ENSMUSP00000063258 ENSMUSP00000063258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]