SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000138803 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000138803
Domain Number - Region: 13-52
Classification Level Classification E-value
Superfamily CalX-like 0.0186
Family CalX-beta domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000138803   Gene: ENSMUSG00000079055   Transcript: ENSMUST00000182366
Sequence length 122
Comment pep:putative chromosome:GRCm38:12:81202397:81294674:-1 gene:ENSMUSG00000079055 transcript:ENSMUST00000182366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGISEVTDRKLTVEEEEAKRIAEMGKPVLGEHPKLEVIIEESYEFKSTVDKLIKKTNL
ALVVGTHSWRDQFMEAITVSAGGDEDEDESGEERLPSCFDYVMHFLTVFWKVLFACVPPT
EY
Download sequence
Identical sequences S4R2V4
ENSMUSP00000138803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]