SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139122 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139122
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 1.15e-36
Family Ribosomal protein L20 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139122   Gene: ENSMUSG00000029066   Transcript: ENSMUST00000137487
Sequence length 149
Comment pep:known chromosome:GRCm38:4:155803650:155809975:1 gene:ENSMUSG00000029066 transcript:ENSMUST00000137487 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MVFLTTRLWLRNRLTDRYWRVQEVLKHAQHFRGRKNRCYRLAVRAVTRAFVKCTKARRLK
KRNLRTLWINRITAASQEHGLKYPAFIVNLIKCQVELNRKVLVDLAIYEPKTFKSLAALA
KRRQQEGFAAALGDGKEPEGIFSRVVQYH
Download sequence
Identical sequences Q9CQL4
ENSMUSP00000030942 ENSMUSP00000139122 NP_079846.1.92730 XP_006539167.1.92730 ENSMUSP00000030942 10090.ENSMUSP00000030942 ENSMUSP00000030942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]