SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139169 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139169
Domain Number 1 Region: 25-85
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.35e-19
Family Ribosomal protein L20 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139169   Gene: ENSMUSG00000029066   Transcript: ENSMUST00000185148
Sequence length 112
Comment pep:novel chromosome:GRCm38:4:155803647:155808798:1 gene:ENSMUSG00000029066 transcript:ENSMUST00000185148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFLTTRLWLRNRLTDRYWRVQEVLKHAQLWINRITAASQEHGLKYPAFIVNLIKCQVEL
NRKVLVDLAIYEPKTFKSLAALAKRRQQEGFAAALGDGKEPEGIFSRVVQYH
Download sequence
Identical sequences V9GXI7
ENSMUSP00000139169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]