SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139249 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139249
Domain Number 1 Region: 1-170
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 1.57e-51
Family Tetrapyrrole methylase 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139249   Gene: ENSMUSG00000033554   Transcript: ENSMUST00000185098
Sequence length 177
Comment pep:known chromosome:GRCm38:3:115888165:115934361:1 gene:ENSMUSG00000033554 transcript:ENSMUST00000185098 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLILADREE
VEQEADNIFKDADVSDVAFLVVGDPFGATTHSDLILRATKLGIPYQVIHNASIMNAVGCC
GLQLYRFGETVSIVFWTDTWRPESFFDKVKRNRANGMHTLCLLDIKVKEQSLENLIR
Download sequence
Identical sequences V9GXP1
XP_006502102.1.92730 ENSMUSP00000139249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]