SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139582 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139582
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily Histone-fold 4.19e-29
Family Nucleosome core histones 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139582   Gene: ENSMUSG00000101819   Transcript: ENSMUST00000189531
Sequence length 105
Comment pep:putative chromosome:GRCm38:X:11302432:11302926:1 gene:ENSMUSG00000101819 transcript:ENSMUST00000189531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKMQRRRRQKRTRSQRGELPLSLVDRFLREEFHSSRLSSSALSFLTSVLEYLTSNILE
LAGEVAQTTGRKRIAPEDVHLVVQNNEQLRQLFKPGGTSVNEDDN
Download sequence
Identical sequences A0A087WP11
NP_001229876.1.92730 ENSMUSP00000139582 ENSMUSP00000136495 10090.ENSMUSP00000094248 ENSMUSP00000132668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]