SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139831 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139831
Domain Number 1 Region: 25-137
Classification Level Classification E-value
Superfamily Immunoglobulin 4.07e-20
Family V set domains (antibody variable domain-like) 0.00034
Further Details:      
 
Domain Number 2 Region: 154-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000745
Family C2 set domains 0.067
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000139831
Domain Number - Region: 240-356
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0424
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139831   Gene: ENSMUSG00000034359   Transcript: ENSMUST00000186969
Sequence length 400
Comment pep:known chromosome:GRCm38:4:112613740:112652248:1 gene:ENSMUSG00000034359 transcript:ENSMUST00000186969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATGVLLCVVLHFLQMVTQSSEKFTVTGLQRPVLAPLGGNVELSCQLSPPQQAQHMEIR
WFRNRYREPVYLYRNGKDLHGETISKYVERTELLKDDIGKGKVTLRIFKLTADDDGSYHC
VFKVGEFYEEHITEIKVTATSSVMYILMQPPNIKGVMLECHSGGWFPQPHMEWRDNKGNI
IPATSKAHSQDENKLFNMTMTLLIEASSHRSITCYLQNLLTHQEESISIVLSGELFSWKR
VWIMILTTIGFMMIAFCMTYCVQQHLLYGTFSKGKCHWLKSTMIFMFSVIAVTGVMLILH
LKQRVPVSDQHFELDTLWLEDISVILCVLIVFIIKLISFIYFRLEGDHQGWSLPPYLSAT
PTAAICRLAVPEYSRGHLQLDSEDDLAGMGPSPFFITPCF
Download sequence
Identical sequences A7XUX6
NP_001272892.1.92730 ENSMUSP00000039201 ENSMUSP00000139831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]