SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000139906 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000139906
Domain Number 1 Region: 8-186
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 1.69e-60
Family Dimeric isocitrate & isopropylmalate dehydrogenases 0.0000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000139906   Gene: ENSMUSG00000025950   Transcript: ENSMUST00000188876
Sequence length 187
Comment pep:known chromosome:GRCm38:1:65166244:65186500:-1 gene:ENSMUSG00000025950 transcript:ENSMUST00000188876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKIQGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKDGTQKVTYMVHDFEEGGGVAM
GMYNQDK
Download sequence
Identical sequences A0A087WPT4
ENSMUSP00000139906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]