SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140153 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140153
Domain Number 1 Region: 2-45
Classification Level Classification E-value
Superfamily Kringle-like 2.26e-19
Family Fibronectin type II module 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140153   Gene: ENSMUSG00000026193   Transcript: ENSMUST00000186613
Sequence length 71
Comment pep:known chromosome:GRCm38:1:71629457:71641288:-1 gene:ENSMUSG00000026193 transcript:ENSMUST00000186613 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAQFPPHPVECPGAF
THHQVHSQMET
Download sequence
Identical sequences A0A087WQE0
ENSMUSP00000140153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]