SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140464 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140464
Domain Number 1 Region: 69-189
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000188
Family BTB/POZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140464   Gene: ENSMUSG00000101294   Transcript: ENSMUST00000186329
Sequence length 498
Comment pep:novel chromosome:GRCm38:X:33575398:33577314:-1 gene:ENSMUSG00000101294 transcript:ENSMUST00000186329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLVSRVLRCRDSSLLEPQPEAIAGASYIPGSRKRKRNSLEELATSSNVHGPQNQGMYP
HQVLNYIYWKRVKISSNDAYQNLFLDGHDSDIKIHALGKTWCLHKVFLCQSGYFANILKG
TWRESHHGVINLIIKNEDIDTRSLHFVFGALYTDADLSITPLEVPQVLAAACLLRVDRVI
QQCEGIMKETINRNTVCSYYLAAETYRLKAVKTRCFEWLLCNLMVHPSVALYKEVDLKLM
YVLALSSDLLVMQKEIDVYTTLKIWMFLYLNPCWNGTMKQLLQHANNWLSTHMAYVDNIS
FLESEEGLIFQPVFKKLRFQHIICDLTSTTILEQDRLIPMAWLSPIYKQQWLTLLRTQEY
GVIGPQVINEQELEECTMRCGTMIPKDGRYTWKWSVGRLGFPLRVTFTRQCVILRQRCQR
CDGSACHNHIRNVIFRITLVCFDSNKRVTFRKTTGYKILTFEYKEEQIVMKLDSDVLTFP
MCIFCNFLFVNLGNAENK
Download sequence
Identical sequences A0A087WR44
NP_001229944.1.92730 10090.ENSMUSP00000100751 ENSMUSP00000100751 ENSMUSP00000140464 ENSMUSP00000100751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]