SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140592 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140592
Domain Number 1 Region: 39-452
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 3.14e-100
Family Iron-containing alcohol dehydrogenase 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140592   Gene: ENSMUSG00000025911   Transcript: ENSMUST00000190654
Sequence length 457
Comment pep:known chromosome:GRCm38:1:9548119:9580673:1 gene:ENSMUSG00000025911 transcript:ENSMUST00000190654 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XTHLLRHLQSTACQCPTHSHTYSQAPGPSGKTADYAFEMAVSNIRYGAGVTKEVGMDLQN
MGAKNVCLMTDKNLSQLPPVQIVMDSLSKNGISFQVYDDVRVEPTDGSFMDAIEFAKKGA
FDAYVAVGGGSTMDTCKAANLYASSPHSEFLDYVNAPIGKGKPVTVPLKPLIAVPTTSGT
GSETTGVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPCQVVANSGFDVLCHALES
YTAIPYSMRSPCPSNPIQRPAYQGSNPISDIWAVHALQIVAKYLKRAVRNPDDLEARSKM
HLASAFAGIGFGNAGVHLCHGMSYPISGLVKTYKAKEYNVDHPLVPHGLSVVLTSPAVFT
FTAQMFPERHLETAGILGANIRTARIQDAGLVLADALRKFLFDLNVDDGLAALGYSKDDI
PSLVKGTLPQERVTKLAPRAQSEEDLSALFEASMKLY
Download sequence
Identical sequences A0A087WRE7
ENSMUSP00000140592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]