SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140816 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140816
Domain Number 1 Region: 1359-1530
Classification Level Classification E-value
Superfamily Fibronectin type III 1.58e-26
Family Fibronectin type III 0.00000649
Further Details:      
 
Domain Number 2 Region: 1724-1891
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-26
Family Fibronectin type III 0.00000981
Further Details:      
 
Domain Number 3 Region: 1543-1713
Classification Level Classification E-value
Superfamily Fibronectin type III 5.88e-24
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 908-1076
Classification Level Classification E-value
Superfamily Fibronectin type III 4.58e-23
Family Fibronectin type III 0.0006
Further Details:      
 
Domain Number 5 Region: 724-890
Classification Level Classification E-value
Superfamily Fibronectin type III 2.48e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-21
Family Fibronectin type II module 0.0000527
Further Details:      
 
Domain Number 7 Region: 347-402
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-21
Family Fibronectin type II module 0.0000664
Further Details:      
 
Domain Number 8 Region: 1174-1346
Classification Level Classification E-value
Superfamily Fibronectin type III 6.31e-20
Family Fibronectin type III 0.00000923
Further Details:      
 
Domain Number 9 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000102
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 10 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000288
Family Fibronectin type I module 0.0045
Further Details:      
 
Domain Number 11 Region: 2133-2176
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000536
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 12 Region: 618-696
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000952
Family Fibronectin type III 0.00000585
Further Details:      
 
Domain Number 13 Region: 472-512
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000116
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 14 Region: 231-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000144
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 15 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000449
Family Fibronectin type I module 0.0000693
Further Details:      
 
Domain Number 16 Region: 185-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000107
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 17 Region: 2088-2131
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000126
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 18 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000301
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 19 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 20 Region: 2176-2217
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000144
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 21 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000183
Family Fibronectin type I module 0.00033
Further Details:      
 
Domain Number 22 Region: 2001-2065
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000429
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 23 Region: 1093-1179
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000154
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140816   Gene: ENSMUSG00000026193   Transcript: ENSMUST00000190780
Sequence length 2271
Comment pep:known chromosome:GRCm38:1:71585524:71653172:-1 gene:ENSMUSG00000026193 transcript:ENSMUST00000190780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVAVSQSKPGCFDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYKVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGGYMLECLCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASAGSGSFTDVRTAIYQPQTHP
QPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHAVLVQTRGGNSNGALC
HFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKFVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRPKTSTGRWKEATIP
GHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTRFDFTTSASTPVTSNTVTGETAPYSPV
VATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLL
PGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTGT
PRSDNVPPPTDLQFVELTDVKVTIMWTPPDSVVSGYRVEVLPVSLPGEHGQRLPVNRNTF
AEITGLSPGVTYLFKVFAVHQGRESNPLTAQQTTKLDAPTNLQFVNETDRTVLVTWTPPR
ARIAGYRLTAGLTRGGQPKQYNVGPLASKYPLRNLQPGSEYTVTLVAVKGNQQSPKATGV
FTTLQPLRSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVS
GLTPGVEYTYTIQVLRDGQERDAPIVNRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTP
DITGYRITTTPTNGQQGTSLEEVVHADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISD
TVVPAVPPPTDLRFTNIGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVAELSISPSDN
AVVLTNLLPGTEYLVSVSSVYEQHESIPLRGRQKTGLDSPTGFDSSDITANSFTVHWVAP
RAPITGYIIRHHAEHSVGRPRQDRVPPSRNSITLTNLNPGTEYVVSIIAVNGREESPPLI
GQQATVSDIPRDLEVIASTPTSLLISWEPPAVSVRYYRITYGETGGNSPVQEFTVPGSKS
TATINNIKPGADYTITLYAVTGRGDSPASSKPVSINYKTEIDKPSQMQVTDVQDNSISVR
WLPSTSPVTGYRVTTTPKNGLGPSKTKTASPDQTEMTIEGLQPTVEYVVSVYAQNRNGES
QPLVQTAVTTIPAPTNLKFSQVTPTSFTAQWIAPSVQLTGYRVRVNPKEKTGPMKEINLS
PDSSSVIVSGLMVATKYEVSVYALKDTLTSRPAQGVITTLENVSPPRRARVTDATETTIT
ISWRTKTETITGFQVDAIPANGQTPVQRSISPDVRSYTITGLQPGTDYKIHLYTLNDNAR
SSPVIIDASTAIDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPRP
RPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTVQKTPFITNPGYDTENGIQL
PGTTHQQPSVGQQMIFEEHGFRRTTPPTAATPVRLRPRPYLPNVDEEVQIGHVPRGDVDY
HLYPHVPGLNPNASTGQEALSQTTISWTPFQESSEYIISCQPVGTDEEPLQFQVPGTSTS
ATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAVSEGLNQPTDDSCFDPYTVSHYA
IGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQRMSC
TCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRP
GAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPIECFMPLDVQADRDDSRE
Download sequence
Identical sequences B9EHT6
ENSMUSP00000140816 NP_001263340.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]