SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140820 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140820
Domain Number 1 Region: 25-186
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.87e-63
Family Glycosyl hydrolases family 35 catalytic domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140820   Gene: ENSMUSG00000026200   Transcript: ENSMUST00000185448
Sequence length 188
Comment pep:putative chromosome:GRCm38:1:75202719:75210813:-1 gene:ENSMUSG00000026200 transcript:ENSMUST00000185448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPDLPSLLLRLVVLLLLSQAEARSFVVDREHDRFLLDGVPFRYVSGSLHYFRVPPVLWA
DRLLKMQLSGLNAVQFYVPWNYHEPEPGIYNFNGSRDLIAFLNEAAKVNLLVILRPGPYI
CAEWEMGGLPSWLLRNPNIHLRTSDPAFLEAVDSWFKVLLPKIYPFLYHNGGNIISIQVE
NEYGSYKA
Download sequence
Identical sequences A0A087WRY5
ENSMUSP00000140820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]