SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140881 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140881
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 2.35e-25
Family Tubulin, GTPase domain 0.00000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140881   Gene: ENSMUSG00000026202   Transcript: ENSMUST00000188593
Sequence length 75
Comment pep:putative chromosome:GRCm38:1:75215612:75217434:-1 gene:ENSMUSG00000026202 transcript:ENSMUST00000188593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKH
VPRAVFVDLEPTVIV
Download sequence
Identical sequences A0A087WS35 A0A286X8D7 A0A287DAG8
ENSMUSP00000140881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]