SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140893 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140893
Domain Number 1 Region: 16-69
Classification Level Classification E-value
Superfamily ALDH-like 0.0000445
Family ALDH-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140893   Gene: ENSMUSG00000037263   Transcript: ENSMUST00000189124
Sequence length 72
Comment pep:known chromosome:GRCm38:19:3958806:3972102:1 gene:ENSMUSG00000037263 transcript:ENSMUST00000189124 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSTKGKHPRADQGTDPFEEKLQRLKEAFNTGKTKTAKFRAEQLQSLGRFLQDNSKQLHDA
LDGDLGKASSQT
Download sequence
Identical sequences A0A087WS45
ENSMUSP00000140893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]