SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000140907 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000140907
Domain Number 1 Region: 1359-1530
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-26
Family Fibronectin type III 0.00000649
Further Details:      
 
Domain Number 2 Region: 1814-1981
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-26
Family Fibronectin type III 0.00000981
Further Details:      
 
Domain Number 3 Region: 1542-1707
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-23
Family Fibronectin type III 0.0000135
Further Details:      
 
Domain Number 4 Region: 908-1076
Classification Level Classification E-value
Superfamily Fibronectin type III 4.5e-23
Family Fibronectin type III 0.0006
Further Details:      
 
Domain Number 5 Region: 724-890
Classification Level Classification E-value
Superfamily Fibronectin type III 2.48e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 6 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-21
Family Fibronectin type II module 0.0000527
Further Details:      
 
Domain Number 7 Region: 347-402
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-21
Family Fibronectin type II module 0.0000664
Further Details:      
 
Domain Number 8 Region: 1174-1347
Classification Level Classification E-value
Superfamily Fibronectin type III 5.11e-20
Family Fibronectin type III 0.00000923
Further Details:      
 
Domain Number 9 Region: 1719-1809
Classification Level Classification E-value
Superfamily Fibronectin type III 4.08e-18
Family Fibronectin type III 0.00000668
Further Details:      
 
Domain Number 10 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000101
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 11 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000288
Family Fibronectin type I module 0.0045
Further Details:      
 
Domain Number 12 Region: 2128-2171
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000523
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 13 Region: 618-696
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000952
Family Fibronectin type III 0.00000585
Further Details:      
 
Domain Number 14 Region: 472-512
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000116
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 15 Region: 231-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000144
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 16 Region: 94-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000449
Family Fibronectin type I module 0.0000693
Further Details:      
 
Domain Number 17 Region: 185-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000106
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 2083-2126
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000108
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 19 Region: 50-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000301
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 20 Region: 142-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 21 Region: 2171-2212
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000144
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 22 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000183
Family Fibronectin type I module 0.00033
Further Details:      
 
Domain Number 23 Region: 1998-2060
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000556
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 24 Region: 1093-1179
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000143
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000140907   Gene: ENSMUSG00000026193   Transcript: ENSMUST00000188674
Sequence length 2266
Comment pep:known chromosome:GRCm38:1:71585523:71653172:-1 gene:ENSMUSG00000026193 transcript:ENSMUST00000188674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVAVSQSKPGCFDNGKHY
QINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYKVGDTYERPKDSM
IWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGGYMLECLCLGNGKGEWTC
KPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQDTRTS
YRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASAGSGSFTDVRTAIYQPQTHP
QPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHAVLVQTRGGNSNGALC
HFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSWEKFVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEPSHITKYILRWRPKTSTGRWKEATIP
GHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTRFDFTTSASTPVTSNTVTGETAPYSPV
VATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLL
PGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVFIQQETTGT
PRSDNVPPPTDLQFVELTDVKVTIMWTPPDSVVSGYRVEVLPVSLPGEHGQRLPVNRNTF
AEITGLSPGVTYLFKVFAVHQGRESNPLTAQQTTKLDAPTNLQFVNETDRTVLVTWTPPR
ARIAGYRLTAGLTRGGQPKQYNVGPLASKYPLRNLQPGSEYTVTLVAVKGNQQSPKATGV
FTTLQPLRSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVS
GLTPGVEYTYTIQVLRDGQERDAPIVNRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTP
DITGYRITTTPTNGQQGTSLEEVVHADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISD
TVVPAVPPPTDLRFTNIGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVAELSISPSDN
AVVLTNLLPGTEYLVSVSSVYEQHESIPLRGRQKTGLDSPTGFDSSDITANSFTVHWVAP
RAPITGYIIRHHAEHSVGRPRQDRVPPSRNSITLTNLNPGTEYVVSIIAVNGREESPPLI
GQQATVSDIPRDLEVIASTPTSLLISWEPPAVSVRYYRITYGETGGNSPVQEFTVPGSKS
TATINNIKPGADYTITLYAVTGRGDSPASSKPVSINYKTEIDKPSQMQVTDVQDNSISVR
WLPSTSPVTGYRVTTTPKNGLGPSKTKTASPDQTEMTIEGLQPTVEYVVSVYAQNRNGES
QPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIRELFPAPD
GEDDTAELQGLRPGSEYTVSVVALHDDMESQPLIGIQSTAIPAPTNLKFSQVTPTSFTAQ
WIAPSVQLTGYRVRVNPKEKTGPMKEINLSPDSSSVIVSGLMVATKYEVSVYALKDTLTS
RPAQGVITTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAIPANGQTPVQRSI
SPDVRSYTITGLQPGTDYKIHLYTLNDNARSSPVIIDASTAIDAPSNLRFLTTTPNSLLV
SWQAPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQK
SEPLIGRKKTGQEALSQTTISWTPFQESSEYIISCQPVGTDEEPLQFQVPGTSTSATLTG
LTRGVTYNIIVEALQNQRRHKVREEVVTVGNAVSEGLNQPTDDSCFDPYTVSHYAIGEEW
ERLSDAGFKLTCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQRMSCTCLGN
GKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAAEP
SPDGTTGHTYNQYTQRYNQRTNTNVNCPIECFMPLDVQADRDDSRE
Download sequence
Identical sequences A0A087WS56
ENSMUSP00000140907 NP_001263341.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]