SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000025767 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000025767
Domain Number 1 Region: 173-322
Classification Level Classification E-value
Superfamily TPR-like 2.85e-19
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 
Domain Number 2 Region: 7-94,132-158
Classification Level Classification E-value
Superfamily FKBP-like 1.55e-18
Family FKBP immunophilin/proline isomerase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000025767   Gene: ENSMUSG00000024847   Transcript: ENSMUST00000025767
Sequence length 330
Comment pep:known chromosome:GRCm38:19:4114464:4121575:-1 gene:ENSMUSG00000024847 transcript:ENSMUST00000025767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLIARLREDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGKPM
ELIVGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAEGKDPLEGQRH
CCGIAQMHEHSSLGHADLDALQQNPQPLIFHIEMLKVESPGTYQQDPWAMTDEEKAKAVP
VIHQEGNRLYREGQVKEAAAKYYDAIACLKNLQMKEQPGSPDWIQLDLQITPLLLNYCQC
KLVAQEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAP
VVSRELRALETRIRQKDEEDKARFRGIFSH
Download sequence
Identical sequences O08915
ENSMUSP00000025767 ENSMUSP00000113807 ENSMUSP00000137722 ENSMUSP00000137847 ENSMUSP00000025767 10090.ENSMUSP00000113807 mmt010015175.1 NP_001263213.1.92730 NP_057875.1.92730 XP_006531704.2.92730 XP_006531705.1.92730 ENSMUSP00000025767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]