SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000030683 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000030683
Domain Number 1 Region: 486-723
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.19e-58
Family Eukaryotic proteases 0.000000011
Further Details:      
 
Domain Number 2 Region: 116-214
Classification Level Classification E-value
Superfamily Kringle-like 2.13e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 211-294
Classification Level Classification E-value
Superfamily Kringle-like 1.35e-33
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 303-386
Classification Level Classification E-value
Superfamily Kringle-like 1.69e-31
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 5 Region: 382-478
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-28
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 37-126
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 5.89e-22
Family Hairpin loop containing domain 0.00000997
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000030683   Gene: ENSMUSG00000028864   Transcript: ENSMUST00000030683
Sequence length 728
Comment pep:known chromosome:GRCm38:5:16553550:16619439:1 gene:ENSMUSG00000028864 transcript:ENSMUST00000030683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWGTKLLPVLLLQHVLLHLLLLHVAIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLLKI
KTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVP
METTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL
Download sequence
Identical sequences Q08048
ENSMUSP00000030683 ENSMUSP00000030683 NP_001276387.1.92730 NP_001276388.1.92730 NP_034557.3.92730 10090.ENSMUSP00000030683 ENSMUSP00000030683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]