SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032912 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032912
Domain Number 1 Region: 114-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.84e-52
Family NadC C-terminal domain-like 0.0000236
Further Details:      
 
Domain Number 2 Region: 9-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.92e-25
Family NadC N-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032912   Gene: ENSMUSG00000030674   Transcript: ENSMUST00000032912
Sequence length 299
Comment pep:known chromosome:GRCm38:7:127107114:127122226:-1 gene:ENSMUSG00000030674 transcript:ENSMUST00000032912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPEGLQLLLPPTTLAALANSWLQEDCPGLNFASLVTGSAPSQAVLWAKSPGVLAGRPFF
DAIFTQLNCQVSWFLPEGSKLVPVVKVAEVKGPAHHLLLGERVALNTLARCSGIASAAAT
AVEVARSTGWTGHVAGTRKTTPGFRLVEKYGLQVGGAACHRYDLGGMVMVKDNHVVAAGS
MERAVLKARQAAGFSLKVEVECSSLEEAFRAAEAGADLVMLDNFKPEELHPTAATLKARF
PSVSVEASGGVTLDNLTQFCGTHIDVISLGMLTQAAPALDFSLKLFAEGDTPVPHARRF
Download sequence
Identical sequences Q91X91
10090.ENSMUSP00000032912 399922 NP_598447.1.92730 ENSMUSP00000032912 ENSMUSP00000032912 ENSMUSP00000032912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]