SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038610 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038610
Domain Number 1 Region: 543-636
Classification Level Classification E-value
Superfamily TAFH domain-like 3.14e-35
Family TAFH domain-like 0.00000302
Further Details:      
 
Domain Number 2 Region: 829-876
Classification Level Classification E-value
Superfamily Histone-fold 4.1e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038610   Gene: ENSMUSG00000039117   Transcript: ENSMUST00000041618
Sequence length 1042
Comment pep:known chromosome:GRCm38:2:179912146:179976646:-1 gene:ENSMUSG00000039117 transcript:ENSMUST00000041618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPELRAAAAGALGN
HVVSGSPAGAAGAGPAASAEGAPAAAPEPPPAGRARPAGGGPRRPGSSSPRRLLVPAGPA
PAPAKLRPLPEASAGPCPAAAAAAAATAAAVAGPDPAAAAPPAGPGASKPGPPGPPGPGA
AQTLNGSAAPPTAPHAAPAVSPVNNGPAPPPAAGSVIQAAPAPAAPSPPAAPAPAAPPPP
APPAPVAPARPPGHPAAPAPPVSPAAAAAAAAAAAAAQNGAAPAPAAASGGAAGLGQPGA
GAQGAKAEAPKPGPGPGPGPAAAAAAAGVAGGGAAGSVLLGPAMPGALPGPAPGTPAGLA
KGAAAATPSLPRTPAATTGAIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSEN
GQLLMIPQQALAQMQAHAQAQPQSTMAPRPATPTGAPPVQISTVQAPGTPIIARQVTPTT
IIKQVSQAQTTVQPTTTLQRSPGVQPQLVLGGSAQPASLGTATAVQTGTPQRTVPGASTT
STAATETMENVKKCKSFLSTLIKLASSGKQSTETAANVKDLVQNLLDGKIEAEDFTSRLY
RELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQQPPASQATTALTAVVLSSSVQ
RTAGKTAASVTSALQPPVISLTQPTQVGVGKQAPPTPLVIQQPPKPGALIRPPQVTLTQT
PMVALRQPHNRIMLTTPQQIQLNQLQPVPVVKPTVLPGTKALSTVSAQAAAAQKNKLKEP
GGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDDTFLLPAPLQRRIL
EIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQ
LKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRD
ANLTALAAIGPRKKRKVDCTGPGSGAEGSGPGAAVPGGSGVGTPRQFTRQRITRVNLRDL
IFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences E9QAP7
ENSMUSP00000118917 ENSMUSP00000038610 ENSMUSP00000038610 NP_001074561.1.92730 10090.ENSMUSP00000038610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]