SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000044048 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000044048
Domain Number 1 Region: 150-305
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 3.83e-45
Family Bcl-2 inhibitors of programmed cell death 0.0000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000044048   Gene: ENSMUSG00000038612   Transcript: ENSMUST00000037947
Sequence length 331
Comment pep:known chromosome:GRCm38:3:95658721:95663176:1 gene:ENSMUSG00000038612 transcript:ENSMUST00000037947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARP
PPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPA
VLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPL
GEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVT
NWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFF
HVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Download sequence
Identical sequences P97287
NP_032588.1.92730 ENSMUSP00000044048 ENSMUSP00000044048 ENSMUSP00000044048 10090.ENSMUSP00000044048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]