SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069279 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069279
Domain Number 1 Region: 2-542
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.88e-85
Family Acetyl-CoA synthetase-like 0.00003
Further Details:      
 
Domain Number 2 Region: 753-1094
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.22e-49
Family Quinoprotein alcohol dehydrogenase-like 0.0082
Further Details:      
 
Domain Number 3 Region: 552-610
Classification Level Classification E-value
Superfamily ACP-like 0.0000942
Family Acyl-carrier protein (ACP) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069279   Gene: ENSMUSG00000055923   Transcript: ENSMUST00000069709
Sequence length 1100
Comment pep:known chromosome:GRCm38:5:76875986:76902187:-1 gene:ENSMUSG00000055923 transcript:ENSMUST00000069709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVLRTASVYMDRTAVCFDEGNNQPPVCYSYKALLSAASELSHFLIAHCDFGGIRE
IGLYCQPGINLPSWILGILQVPAAYAPIDPDSPPSLSTYFMKKCDLKYVLVEKQQLSKFK
SSHETVLNYDTVSVEHKDLALFRLHWEDGRVSTVLGDRADQHKVTDREDRVSAESRTPEK
EHMDMRHDGCLAYVLHTSGTTGTPKIVRVPHACILPNIQHFRSLFDITQEDILFLASPLT
FDPSVVEIFVSLSSGACLLIVPTSVKVLPSKLADILFSRHRVTVLQATPTLLRRFGSELI
KSTVLSAHTSLRVLALGGEAFPSLTILKSWRGKGNRTQIFNIYGITEVSSWATFYRIPEE
ILNSAVKHESPVQLGSPLLGTVIEVRDQNGSPVLEGTGQVFLGGKNRVCFLDDEMTVPLG
TMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIALVQQVAEELRQVESCAVTWYNQER
LILFIVSKVDLVKDCIFKELQKHLPAHALPDDMVLIDTLPFTCHGKVDVSELNKIYLDYI
SSQPRNELHGKEELWGKLQYLWKSILCLPEDPEDTLKVPANSVFLDSGGDSLKSMRLLSE
IERLTGTAIPGLLEVILSSSLLDVYNHIVQAVFTPEDRKANRSYTTKRKFSDADPEEASG
KPARLESAWPSNHAGETNSVIALSRGSQVLSLGAGRLLTQLGLCLPVCSLDLIPQTNTQI
LKSLSPPAPDENLEKPPLFQQGSPVVGAMAMALRERWRSDTGKCVDASPLLVRAAVQDKP
STTVYIGSHSHTVKAVDLSSGETRWEQLLGDRIESSACVSKCGNFIVVGCYNGLVYVLKS
NSGEKYWTFTTEDAVKSSPAVDPTTGLIYVGSHDQHAYALDIYEKKCVWKLNCEGALFSS
PCVSLSPHHLYCATLGGLLLALNPASGSTVWKRSCGKPLFSSPRCYQQYICIGCVDGSLL
CFTHSGEQVWRFAAGGPIFSSPCVSAAEQEIFFGSHDCFIYCCSKEGHLRWKFETTARVY
ATPFAFSNHPRSDDALLAAASTDGKLWVLESRSGELRSVYELPGEVFSSPVVWESMLVIG
CRNNYIYCLDLLCGDKNNQV
Download sequence
Identical sequences Q80WC9
ENSMUSP00000113792 ENSMUSP00000069279 ENSMUSP00000113792 10090.ENSMUSP00000113792 NP_776126.1.92730 XP_006534916.1.92730 XP_011247723.1.92730 XP_011247724.1.92730 ENSMUSP00000069279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]