SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000094097 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000094097
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily POZ domain 2.36e-32
Family BTB/POZ domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000094097   Gene: ENSMUSG00000043929   Transcript: ENSMUST00000096369
Sequence length 248
Comment pep:known chromosome:GRCm38:X:94234987:94255968:1 gene:ENSMUSG00000043929 transcript:ENSMUST00000096369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMF
TADMRERDQDKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFC
CSFLLAKICLENCAEIMRLLDDFGVNIEGVREKLDAFLLDNFVPLMSRPDFLSYLSFEKL
MSYLDNDHLSRFPEIELYEAVQSWLRHDRRRWRHTDTIIQNIRFCLMTPSSVFEKVGTFE
SDRQDSSI
Download sequence
Identical sequences NP_001034149.1.92730 MmR283 ENSMUSP00000094097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]