SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000107591 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000107591
Domain Number 1 Region: 186-326
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 5.57e-25
Family Bcl-2 inhibitors of programmed cell death 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000107591   Gene: ENSMUSG00000030200   Transcript: ENSMUST00000111960
Sequence length 328
Comment pep:known chromosome:GRCm38:6:134414428:134438115:1 gene:ENSMUSG00000030200 transcript:ENSMUST00000111960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTSVYDLEDIPLEDDDPNSIEFKILAFYARHHVFKNTPAVFSPKLSRTRSLSQKALGT
WSTDSWTQVSLPCRGSPSSEKNISLGKKKSSWRTLFRVAEKEEGLPSSPKEIRAQGPQGP
FPVERQSGFHNQHWPRSLSSVEQRLESEVVDSKVACIANRVAEIVYSWPPPDVIHSQGGS
KLKERVSEILYFRFEGPCDSKNKDGEDQIISKIVELLKFSGDQLGREIKKDKALMSSFQD
GLSYSTFKTITDLFLRDVDTRGESEVKARGFKAALAIDAIAKLTAIDNHPMNRMLGFGTK
YLREYFSPWVQQNGGWEKILGISHEEVD
Download sequence
Identical sequences Q9CPT0
10090.ENSMUSP00000107591 ENSMUSP00000032321 ENSMUSP00000032321 ENSMUSP00000107591 ENSMUSP00000132525 NP_080054.1.92730 XP_006506547.1.92730 ENSMUSP00000032321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]