SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119153 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119153
Domain Number 1 Region: 247-347
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.94e-29
Family Ras-binding domain, RBD 0.00000185
Further Details:      
 
Domain Number 2 Region: 405-502
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.49e-22
Family FHA domain 0.00000196
Further Details:      
 
Domain Number 3 Region: 39-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.45e-22
Family Ras-binding domain, RBD 0.015
Further Details:      
 
Domain Number 4 Region: 1007-1103
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-22
Family PDZ domain 0.0000272
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000119153
Domain Number - Region: 1374-1435
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0863
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119153   Gene: ENSMUSG00000068036   Transcript: ENSMUST00000137784
Sequence length 1827
Comment pep:novel chromosome:GRCm38:17:13760599:13904132:1 gene:ENSMUSG00000068036 transcript:ENSMUST00000137784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKD
DREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKKEKEALRQA
SDKEERPSQGDDSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSS
DGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARV
MLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKMKKHVE
GKSLKGKDRADGSGYGSALPPEKLPYLVELSPGRRNHFAYYSYHTYEDGSDSRDKPKLYR
LQLSVTEVGTEKFDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVDGQRISET
TMLQSGMRLQFGTSHVFKFVDPIQDHVLSKRSVDGGLMVKGPRHKPGAVQETTFELGGDV
HSGTALPASRSTTRLDSDRVSSASSTAERGMVKPMIRLDQEQEYRRRENRTQDATGPELI
LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQHRPDISPTERT
HKAIAVVNKMVSMMEGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSRITL
DAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLL
RRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQ
GLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPF
IPTDLIENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQ
EFLDPLCQRGFCRLVPHTRSPGTWTIYFEGADYESHLMRENAELAQPLRKEPEIITVTLK
KQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQER
AAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYN
NSAQNGSPESPQMPWTEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKGPYTSGT
AAKITSVSTGNLCTEEQSPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQSQWPNYE
EKPHVHTESNHSSIAIQRVTRSQEELREEKVYQLERHRVEAGMDRKCDSDMWINQSSSVE
SSTSSQEHLNHSSKSVTPASTLTKSGPGRWKTPAAVLPTPVAVSQPIRTDLPPPPPPPPV
HYTSEFDGIPMDLPLPPPPANQAGPQSAQVAAAEWKKREEHQRWYEKEKARLEEERERKR
REQERKLGQMRSQTLNPASFSPLATQAKPEKPSTLQRPQETVIRELQPQQQPRTIERKDL
QYITISKEELSSGDSLSPDPWKRDAREKLEKQQQMHIVDMLSKEIHELQNKVDRTAEESD
RLRKLMLEWQFQKRLQESKQKDEDDDEEEDDDVDTMLIMQRLEAERRARMQDEERRRQQQ
LEEMRKREAEDRVRQEEDGRHQEEERVKRDAEEKRRQEEGYYSRLEAERRRQHEEAARRL
LEPEEPGLSRPPLPRDYEPPSLSSAPCAPPPPPQRNASYLKTQVLSPDSLFTAKFVAYDE
EEEDYGPAGPNSYSGSAGTAVGAYDAPREAREKLTRSQDADLPGSSGAPENLTFKERQRL
FSQGQDVSDKVKASRKLTELENELNTK
Download sequence
Identical sequences E9Q9C3
10090.ENSMUSP00000119153 ENSMUSP00000119153 ENSMUSP00000118318 XP_006523828.1.92730 ENSMUSP00000119153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]