SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000119426 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000119426
Domain Number 1 Region: 3-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-17
Family KRAB domain (Kruppel-associated box) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000119426   Gene: ENSMUSG00000078876   Transcript: ENSMUST00000126726
Sequence length 92
Comment pep:novel chromosome:GRCm38:2:176831140:176836662:1 gene:ENSMUSG00000078876 transcript:ENSMUST00000126726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLVTYDDVHVNFTQEEGALLETSQKNLYKDVMLETYRNLSAIGMKEVVLQCNPLNLFNV
VKPLHIIVLDKGMKEHIMGRKTITVTNVVKPL
Download sequence
Identical sequences D3Z288
ENSMUSP00000119426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]